Pinkpawpal Kuala Lumpur

Home
Malaysia
Cyberjaya
Pinkpawpal Kuala Lumpur

Pinkpawpal professional pet care and grooming products

26/12/2023

Hohoho~~~ Brunei here we come!!!

Get your Pinkpawpal and Pets Ordinary products from Freshpawssbrunei now!

Pinkpawpal Kuala Lumpur
Pinkpawpal Thailand
Pet Ordinary Malaysia
Pet Ordinary Thailand .thailand

26/12/2023

Pinkpawpal products are now available at Pet Haus KK and Super Meow for those in Kota Kinabalu, Sabah!

Merry Christmas 🎄

26/12/2023

Thank you Monsters factory for the continuous support 💪🏻
Love the view 😍 sea of Pinkpawpal supplements 🤣

Pinkpawpal Kuala Lumpur
Pinkpawpal Thailand

24/12/2023

Order the 3800ml size now and you will receive a free pump head ❤️

Pinkpawpal Kuala Lumpur
Pinkpawpal Thailand

21/12/2023

Loki after his yummy Coco & Joe BARF with Pinkpawpal Kuala Lumpur Gorgeous Coat & Muscle and Immunity Booster 😂

12/12/2023

Congrats to all winners. Thank you Feline Fanciers Federation for collaborating with us ❤️

23/11/2023

Get yours now. Talk to us ❤️

Pinkpawpal Kuala Lumpur
Pinkpawpal Thailand

16/11/2023

Thank you Monsters factory for the suooort.

Those in Miri can get your Pinkpawpal Kuala Lumpur and Pet Ordinary Malaysia products at Monsters Factory 🏭

08/11/2023

Thank you Big White Cat Shop 大白猫店 for your continuous support. Gabby says thank you 🤣🤣

Those in Klang Valley can get you Pinkpawpal products from Big White Cat Shop located at Ara Damansara 👍🏻

Pinkpawpal Kuala Lumpur
Pinkpawpal Thailand

22/10/2023

When I’m busy with orders and Gabby is ‘helping’ me out 😅

Pinkpawpal Kuala Lumpur
Pinkpawpal Thailand

22/10/2023

Before and after grooming by Monsters factory using Pinkpawpal products.

Thank you for sharing.

Pinkpawpal Kuala Lumpur
Pinkpawpal Thailand

20/10/2023

Thank you MeowPalace & Grooming Centre for your continuous support ❤️

Pinkpawpal Kuala Lumpur
Pinkpawpal Thailand

20/10/2023

Thank you Pets Kingdom for the support.

Friends in Tawau, do head over to Pets Kingdom and get a professional grooming for ur beloved pets ❤️

Pinkpawpal Kuala Lumpur
Pinkpawpal Thailand

19/10/2023

Before and after. Thank you Monsters factory for sharing. Good job! Love the result ❤️

Pinkpawpal Kuala Lumpur
Pinkpawpal Thailand

15/10/2023

Thank you fellow Sarawakian Monsters factory for your support 💪

Miri friends, get your Pinkpawpal products from Monster Factory now ❤️

Pinkpawpal Kuala Lumpur
Pinkpawpal Thailand

11/10/2023

Christian: Pinkpawpal Immunity Booster is yummy and keeps me healthy ❤️

GP, DW C**n Elixir’s Christian

Pinkpawpal Kuala Lumpur
Pinkpawpal Thailand

11/10/2023

Thank you Giam Giam for your continuous support.

Friends in Sabah, get your Pinkpawpal products from Giam Giam ❤️

Pinkpawpal Kuala Lumpur
Pinkpawpal Thailand

10/10/2023

Thank you Purr Pets - Pet Shop Kuching for your continuous support ❤️❤️❤️

07/10/2023

Prepare for an exciting visit to Sarawak! This is an exciting trip back to home-state!

Join us for our Pinkpawpal grooming class in Kuching, Sarawak, covering everything from fundamental grooming techniques to preparing cats for shows.

Upon joining our class, you'll receive a comprehensive grooming product set. Join us and master the art of grooming!

We're thrilled to announce that our guest speaker, John Chin, will enlighten us on breed standards and the art of showcasing and presenting your cats in shows. John Chin brings a wealth of experience as a breeder specializing in BSH, Persian, and Exotic cats. He's also an accomplished All-Breed judge and serves as the Regional Director of Feline Fanciers Federation. Born in Kuching, a true Sarawakian😻

Pinkpawpal Kuala Lumpur
Pinkpawpal Thailand

05/10/2023

After grooming with Pinkpawpal ♥️

Pinkpawpal Kuala Lumpur
Pinkpawpal Thailand

24/09/2023

Thank you Lana & Louie Suites .kl for continuous support ♥️

Pinkpawpal Kuala Lumpur
Pinkpawpal Thailand

22/09/2023

Address

No. 6, Jalan Clover 6, Clover Garden Residence
Cyberjaya
63000

Telephone

+60122011606

Website

https://shopee.com.my/pinkpawpalkualalumpur

Alerts

Be the first to know and let us send you an email when Pinkpawpal Kuala Lumpur posts news and promotions. Your email address will not be used for any other purpose, and you can unsubscribe at any time.

Contact The Business

Send a message to Pinkpawpal Kuala Lumpur:

Videos

Flawless is the word ♥️ Groomed with Pinkpawpal professional grooming products ♥️ Pinkpawpal Kuala Lumpur @pinkpawpal_kl Pinkpawpal Thailand @pinkpawpal

Why you need this small comb ❤️ Pinkpawpal Kuala Lumpur https://shp.ee/da2k8b5

Our happy customer. First time grooming using Pinkpawpal grooming products. Pinkpawpal Kuala Lumpur https://shp.ee/gi9kwsz #pinkpawpal #pinkpawpalkl #pinkpawpalprofesionalgroomingproducts

Our furkids love Pinkpawpal Gorgeous Coat & Muscle. Good for their fur and to give them heavier and solid body #pinkpawpalkl #pinkpawpalprofessionalpetcareproducts #pinkpawpalgorgeouscoatandmuscle #pinkpawpal #pinkpawpalprofessionalpetcareproducts

Thanks to our happy customer for sharing ❤️

Pinkpawpal Grooming Spray Facebook: Pinkpawpal Kuala Lumpur Instagram: https://instagram.com/pinkpawpal_kl?igshid=OGQ5ZDc2ODk2ZA== Shopee: https://shp.ee/2af2izv #pinkpawpalkl #pinkpawpalgroomingspray #professionalpetcare #cat #petcare #petgrooming

Pinkpawpal Grooming Spray Facebook: Pinkpawpal Kuala Lumpur Instagram: https://instagram.com/pinkpawpal_kl?igshid=OGQ5ZDc2ODk2ZA== Shopee: https://shp.ee/2af2izv

Eda: No~~ I didn’t do it!! Obviously it’s Pinkpawpal Gorgeous Coat & Muscle all over her face 🤣🤣🤣 Super yummy that cats can’t resist. Call us now! Pinkpawpal Kuala Lumpur Pinkpawpal Thailand #pinkpawpalkl #pinkpawpal #pinkpawpalGORGEOUSCOATANDMUSCLE #petsupplement #professionalpetcare

Thank you for the support. Pinkpawpal Eye & Facial Cleanser #pinkpawpal #pinkpawpalkl #petgrooming #professionalpetcare #pinkpawpaleyeandfacialcleanser

Beautifully groomed by Aleya Natasha Soon of Notty Kitty Cattery. Pinkpawpal 3 steps grooming. Love this girl ❤️ Thank you for the support ❤️ Pinkpawpal Kuala Lumpur Pinkpawpal Thailand #pinkpawpal #pinkpawpalkl #pinkpawpalgrooming #pinkpawpalprofessionalgrooming #oinkpawpalshampoo

Muse loves Pinkpawpal Gorgeous Coat & Muscle mixed with Coco & Joe BARF Yum yum yum 😋 #pinkpawpal #pinkpawpalkl #pinkpawpalsupplement #pinkpawpalgorgeouscoatandmuscle #coconjoebarf

Guess what are they queuing up for? 🤣🤣🤣 Watch till the end 🥰 Pinkpawpal Kuala Lumpur Pinkpawpal Thailand

3 steps grooming with Pinkpawpal. Easy-peasy. Pinkpawpal Kuala Lumpur Pinkpawpal Thailand #pinkpawpalkl #petshampoo #pinkpawpalshampoo #professionalpetcare #pinkpawpal #professionalgrooming

Our happy customer. She approves Pinkpawpal Gorgeous Coat & Muscle S1 #pinkpawpalkl #pinkpawpal #petsupplements #petsupplies #pinkpawpalgorgeouscoatandmuscle

Pinkpawpal S1 Gorgeous Coat & Muscle will solve all your problems. Contain premium natural protein for improving weight & muscle and reduce shedding. Enriched with biotin and omega 3. Nice egg yolk smell will increase appetite. Pets love it! Mix with any kind of food - dry food, wet food or even raw meat. Direction: Mix powder into dry food or mix with warm water into wet food or raw meat. 1 scoop per pet twice a day. Main ingredients: Hen egg yolk, biotin, omega 3, vitamin D, phosphorus, vitamin A, B-complex, riboflavin, selenium, choline, carotenoids #petsupplies #petsupplement #petsupplements #pethealth #petcoat #petcoats #petcoatcare #petmuscles

Every cat loves Pinkpawpal S1 Gorgeous Coat & Muscles Supplement. Increase appetite, gives beautiful coat and strong n muscular body 💪🏻 Thanks to buyer who shared this video ❤️ #pinkpawpalkl #pinkpawpal #petsupplements #pet #petsofinstagram #petlovers #petfriendly #pets #petlover #petsagram #cat #catsofinstagram #catstagram #catlover #catlife #cats_of_world #catloversclub #catsupplement #catsupplements #catsupplementmalaysia

Pinkpawpal No.10 Grooming Spay Rejuvenate Coat without Bathing #pinkpawpalkl #pinkpawpal #petgrooming #petsupplies #coat #grooming #cat #fog #pet #petlovers #petsofinstagram #pets #petlover #petsagram #petstagram #petshampoo #petshampoo🐶🐱🐴🐰 #shampoo

Our happy customer. Yum yum yum~~~ Pinkpawpal S1 Gorgeous Coat & Muscles. Can be mixed into dry food or wet food. Nice egg yolk smell and the fur kids love it! Give them beautiful coat and strong muscles. Talk to us now 😉 #pinkpawpalkl #pinkpawpal #petsupplements #petsupplies #coat #muscle

Our happy customer. Pinkpawpal S1 Gorgeous Coat & Muscles. Can be mixed into dry food or wet food. Nice egg yolk smell and the fur kids love it! Give them beautiful coat and strong muscles. #pinkpawpalkl #pinkpawpal #petsupplements #petsupplies #coat #muscle

Pinkpawpal S1 Gorgeous Coat & Muscles. Can be mixed into dry food or wet food. Nice egg yolk smell and the fur kids love it! Give them beautiful coat and strong muscles. #pinkpawpalkl #pinkpawpal #petsupplements #petsupplies #coat #muscle